Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMTKHYDYIAIGGGSGGIASINRAAMYG QKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTIN KFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNG ETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGY IAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHT NAIPKAVVKNTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGV KTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFN NKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTA MYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGA TKKDFDNTVAIHPTAAEEFVTMR
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 450
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab123214 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ECK3485
    • glutathione oxidoreductase
    • Glutathione reductase
    • gor
    • gorA
    • GR
    • GRase
    • GSHR_ECOLI
    • JW3467
    see all
  • Function
    Maintains high levels of reduced glutathione in the cytosol.
  • Sequence similarities
    Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant E. coli gor protein images

  • 15% SDS-PAGE showing ab123214 (3 µg) at approximately 51.2 kDa.

References for Recombinant E. coli gor protein (ab123214)

ab123214 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up