Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMTKHYDYIAIGGGSGGIASINRAAMYG QKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTIN KFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNG ETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGY IAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHT NAIPKAVVKNTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGV KTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFN NKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTA MYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGA TKKDFDNTVAIHPTAAEEFVTMR
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 450
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab123214 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ECK3485
    • glutathione oxidoreductase
    • Glutathione reductase
    • gor
    • gorA
    • GR
    • GRase
    • GSHR_ECOLI
    • JW3467
    see all
  • Function
    Maintains high levels of reduced glutathione in the cytosol.
  • Sequence similarities
    Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab123214 (3 µg) at approximately 51.2 kDa.

References

ab123214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up