Recombinant E. coli grxB protein (ab106883)

Overview

  • Product name
    Recombinant E. coli grxB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKLYIYDHCPYCLKARMIFGLKNIPVELHV LLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTG KRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASA GNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLR NLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 215
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106883 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK1049
    • Glutaredoxin 2
    • Glutaredoxin 2 (Grx2)
    • Grx2
    • JW1051
    see all
  • Relevance
    GrxB (Glutaredoxin-2) belongs to the glutaredoxin family. Glutaredoxins are oxidized by substrates, and reduced non-enzymatically by glutathione. This protein involved in reducing some disulfides in a coupled system with glutathione reductase. It does not act as hydrogen donor for ribonucleotide reductase.

Recombinant E. coli grxB protein images

  • 15% SDS-PAGE analysis of 3 µg ab106883.

References for Recombinant E. coli grxB protein (ab106883)

ab106883 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up