Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0AE18
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMAISIKTPEDIEKMRVAGRLAAEVLEMIEP YVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHG IPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSL SAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
    • Molecular weight32 kDa including tags
    • Amino acids1 to 264
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab106876 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK0166
    • JW0163
    • Methionine aminopeptidase
    • PepM
  • Relevancemap (Methionine aminopeptidase) removes the amino-terminal methionine from nascent proteins.

Recombinant E. coli map protein images

  • 15% SDS-PAGE analysis of 3 µg ab106876.

References for Recombinant E. coli map protein (ab106876)

ab106876 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"