Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAISIKTPEDIEKMRVAGRLAAEVLEMIEP YVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHG IPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSL SAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 264
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab106876 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK0166
    • JW0163
    • Methionine aminopeptidase
    • PepM
  • Relevance
    map (Methionine aminopeptidase) removes the amino-terminal methionine from nascent proteins.

Images

  • 15% SDS-PAGE analysis of 3 µg ab106876.

References

ab106876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up