Recombinant E. coli Methionine Sulfoxide Reductase A protein (ab106865)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSLFDKKHLVSPADALPGRNTPMPVATLHA VNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPN PTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGND HGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDRHITTEIANATPF YYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 212
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab106865 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Cytosolic methionine S sulfoxide reductase
    • Methionine sulphoxide reductase A
    • Mitochondrial peptide methionine sulfoxide reductase
    • MSR A
    • msrA
    • MSRA_HUMAN
    • peptide met (O) reductase
    • Peptide Met(O) reductase
    • Peptide methionine (S) S oxide reductase
    • Peptide-methionine (S)-S-oxide reductase
    • PMSR
    • Protein methionine S oxide reductase
    • Protein-methionine-S-oxide reductase
    see all
  • Function
    Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
  • Tissue specificity
    Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
  • Sequence similarities
    Belongs to the MsrA Met sulfoxide reductase family.
  • Cellular localization
    Cytoplasm; Cytoplasm. Nucleus and Mitochondrion.
  • Information by UniProt

Recombinant E. coli Methionine Sulfoxide Reductase A protein images

  • 15% SDS-PAGE analysis of 3µg ab106865.

References for Recombinant E. coli Methionine Sulfoxide Reductase A protein (ab106865)

ab106865 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up