Recombinant E. coli Methionine Sulfoxide Reductase A protein (ab106865)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSLFDKKHLVSPADALPGRNTPMPVATLHA VNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPN PTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGND HGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDRHITTEIANATPF YYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 212
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab106865 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Cytosolic methionine S sulfoxide reductase
    • Methionine sulphoxide reductase A
    • Mitochondrial peptide methionine sulfoxide reductase
    • MSR A
    • msrA
    • MSRA_HUMAN
    • peptide met (O) reductase
    • Peptide Met(O) reductase
    • Peptide methionine (S) S oxide reductase
    • Peptide-methionine (S)-S-oxide reductase
    • PMSR
    • Protein methionine S oxide reductase
    • Protein-methionine-S-oxide reductase
    see all
  • Function
    Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
  • Tissue specificity
    Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
  • Sequence similarities
    Belongs to the MsrA Met sulfoxide reductase family.
  • Cellular localization
    Cytoplasm; Cytoplasm. Nucleus and Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106865.

References

ab106865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up