Recombinant E. coli nanA protein (ab106874)

Overview

  • Product nameRecombinant E. coli nanA protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0A6L4
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMATNLRGVMAALLTPFDQQQALDKASLRRL VQFNIQQGIDGLYVGGSTGEAFVQSLSEREQVLEIVAEEAKGKIKLIAHV GCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCDHYRAIIDSAD GLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQ TAQKLQTECNKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEK YLPELKALAQQLMQERG
    • Molecular weight35 kDa including tags
    • Amino acids1 to 297
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab106874 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ECK3214
    • JW3194
    • N acetylneuraminate lyase
    • N acetylneuraminate lyase (aldolase) catabolism of sialic acid
    • N acetylneuraminate pyruvate lyase
    • N acetylneuraminic acid aldolase
    • NALase
    • Npl
    • Sialate lyase
    • Sialic acid aldolase
    • Sialic acid lyase
    see all
  • RelevanceN-acetylneuraminate lyase is the first enzyme in the pathway for degradation of sialic acid (N-acetylneuraminate, or NeuNAc) .
  • Cellular localizationCytoplasmic

Recombinant E. coli nanA protein images

  • 15% SDS PAGE analysis of 3 µg ab106874.

References for Recombinant E. coli nanA protein (ab106874)

ab106874 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"