Recombinant E. coli nanA protein (ab106874)

Overview

  • Product name
    Recombinant E. coli nanA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMATNLRGVMAALLTPFDQQQALDKASLRRL VQFNIQQGIDGLYVGGSTGEAFVQSLSEREQVLEIVAEEAKGKIKLIAHV GCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCDHYRAIIDSAD GLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQ TAQKLQTECNKVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEK YLPELKALAQQLMQERG
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 297
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106874 is purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ECK3214
    • JW3194
    • N acetylneuraminate lyase
    • N acetylneuraminate lyase (aldolase) catabolism of sialic acid
    • N acetylneuraminate pyruvate lyase
    • N acetylneuraminic acid aldolase
    • NALase
    • Npl
    • Sialate lyase
    • Sialic acid aldolase
    • Sialic acid lyase
    see all
  • Relevance
    N-acetylneuraminate lyase is the first enzyme in the pathway for degradation of sialic acid (N-acetylneuraminate, or NeuNAc) .
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS PAGE analysis of 3 µg ab106874.

References

ab106874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up