Recombinant E. coli Nitroreductase protein (ab97948)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQI KTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASH VVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRK DLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 217
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity
    > 95 % SDS-PAGE.
    ab97948 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Dihydropteridine reductase
    • dprA
    • FMN dependent nitroreductase
    • nfnB
    • nfsI
    • ntr
    • Oxygen insensitive NAD(P)H nitroreductase
    see all
  • Relevance
    Nitroreductase shows the ability to reduce quinines. It is an enzyme for activating prodrugs in antibody directed enzyme prodrug therapy. It is also capable of reducing nitrofurazone, quinones and the anti-tumor agent CB1954 (5-(aziridin-1-yl)-2,4-dinitrobenzamide). The reduction of CB1954 results in the generation of cytotoxic species.

Images

  • 15% SDS-PAGE showing ab97948 at approximately 26kDa (3µg).

References

ab97948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up