Overview

  • Product name
    Recombinant E. coli nth protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNKAKRLEILTRLRENNPHPTTELNFSSPF ELLIAVLLSAQATDVSVNKATAKLYPVANTPAAMLELGVEGVKTYIKTIG LYNSKAENIIKTCRILLEQHNGEVPEDRAALEALPGVGRKTANVVLNTAF GWPTIAVDTHIFRVCNRTQFAPGKNVEQVEEKLLKVVPAEFKVDCHHWLI LHGRYTCIARKPRCGSCIIEDLCEYKEKVDI
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 211
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab107150 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • DNA-(apurinic or apyrimidinic site) lyase
    • END3_ECOLI
    • Endonuclease III
    • nth
  • Function
    Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
  • Sequence similarities
    Belongs to the Nth/MutY family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107150 (3µg).

References

ab107150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up