Overview

  • Product nameRecombinant E. coli nth protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0AB83
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMNKAKRLEILTRLRENNPHPTTELNFSSPF ELLIAVLLSAQATDVSVNKATAKLYPVANTPAAMLELGVEGVKTYIKTIG LYNSKAENIIKTCRILLEQHNGEVPEDRAALEALPGVGRKTANVVLNTAF GWPTIAVDTHIFRVCNRTQFAPGKNVEQVEEKLLKVVPAEFKVDCHHWLI LHGRYTCIARKPRCGSCIIEDLCEYKEKVDI
    • Molecular weight26 kDa including tags
    • Amino acids1 to 211
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab107150 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • DNA-(apurinic or apyrimidinic site) lyase
    • END3_ECOLI
    • Endonuclease III
    • nth
  • FunctionHas both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
  • Sequence similaritiesBelongs to the Nth/MutY family.
  • Information by UniProt

Recombinant E. coli nth protein images

  • 15% SDS-PAGE showing ab107150 (3µg).

References for Recombinant E. coli nth protein (ab107150)

ab107150 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"