Recombinant E. coli PANK1 protein (ab123146)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDS VPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVL EQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITT DGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYS HLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFS IYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMT LWKEINWLNLKQNILPTRERASLI LTKSANHAVEEVRLRK
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 316
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123146 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • coaA
    • hPanK
    • hPanK1
    • PANK
    • PANK1
    • PANK1_HUMAN
    • PANK1a
    • PANK1b
    • PanK1beta
    • Pantothenate kinase
    • Pantothenate kinase 1
    • Pantothenic acid kinase 1
    see all
  • Function
    Plays a role in the physiological regulation of the intracellular CoA concentration.
  • Tissue specificity
    Isoform 1 is expressed at high levels in brain, heart, kidney, liver, skeletal muscle and testis. Isoform 2 is detected at much lower levels in kidney, liver, brain and testis and is not detected in heart or skeletal muscle.
  • Pathway
    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 1/5.
  • Sequence similarities
    Belongs to the type II pantothenate kinase family.
  • Domain
    The N-terminal extension, present in isoform 1 may be the regulatory domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant E. coli PANK1 protein images

  • 15% SDS PAGE, 3 µg of ab123146 loaded.

References for Recombinant E. coli PANK1 protein (ab123146)

ab123146 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up