Overview

  • Product name
    Recombinant E. coli ppa protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSLLNVPAGKDLPEDIYVVIEIPANADPIK YEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPL QPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPEL LKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 176
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab109942 was purified using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK4222
    • Inorganic pyrophosphatase
    • IPYR_ECOLI
    • JW4185
    • ppa
    • PPase
    • Pyrophosphate phospho-hydrolase
    see all
  • Sequence similarities
    Belongs to the PPase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant E. coli ppa protein images

  • 15% SDS-PAGE analysis of 3µg ab109942.

References for Recombinant E. coli ppa protein (ab109942)

ab109942 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up