Overview

  • Product nameRecombinant E. coli ppa protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0A7A9
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMSLLNVPAGKDLPEDIYVVIEIPANADPIK YEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPL QPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPEL LKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
    • Molecular weight22 kDa including tags
    • Amino acids1 to 176
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109942 was purified using conventional chromatography techniques
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK4222
    • Inorganic pyrophosphatase
    • IPYR_ECOLI
    • JW4185
    • ppa
    • PPase
    • Pyrophosphate phospho-hydrolase
    see all
  • Sequence similaritiesBelongs to the PPase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant E. coli ppa protein images

  • 15% SDS-PAGE analysis of 3µg ab109942.

References for Recombinant E. coli ppa protein (ab109942)

ab109942 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"