Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENE FKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQ AFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDV KDITADVLKQVK
    • Molecular weight
      18 kDa including tags
    • Amino acids
      21 to 161
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab97397 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Chaperone protein skp
    • DNA binding 17 kDa protein
    • ECK0177
    • Histone like protein HLP 1
    • hlpA
    • JW0173
    • ompH
    • Seventeen kilodalton protein
    • skp
    see all
  • Relevance
    Skp, also known as Seventeen Kilodalton Protein, is a trimeric periplasmic chaperone that assists outer membrane proteins in their folding and insertion into membranes. Skp is required for the efficient release of ompA from the inner membrane, the maintenance of its solubility in the periplasm, and, in association with lipopolysaccharide (LPS), for the efficient folding and insertion of ompA into the outer membrane.
  • Cellular localization
    Periplasm

Recombinant E. coli Skp protein images

  • 15% SDS-PAGE showing ab97397 at approximately 17.9kDa (3µg).

References for Recombinant E. coli Skp protein (ab97397)

ab97397 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up