Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesEscherichia coli
    • SequenceMKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLETALE GHEVGDKFDVAVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAET DQGPVPVEITAVEDDHVVVDGNHMLAGQNLKFNVEVVAIREATEEELAHG HVHGAHDHHHDHDHDGCCGGHGHDHGHEHGGEGCCGGKGNGGCGCH

Specifications

Our Abpromise guarantee covers the use of ab72847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 220 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant SlyD protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab72847 is purified by conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20mM Tris, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • FKBP type peptidyl prolyl cis trans isomerase slyD
    • Histidine rich protein
    • PPIase
    • Rotamase
    • WHP
    see all
  • RelevanceslyD belongs to the FKBP-type PPIase family.Required for lysis of phiX174 infected cells. It binds nickel and zinc with high affinity and 1:1 stoichiometry, copper and cobalt with lower affinity. No binding is detectable for ferrous, ferric, magnesium and calcium ions. The activity of slyD is considerably smaller than the one found in other PPIases with the same substrate. The substrate specificity carried out with 'suc-Ala-Xaa-Pro-Phe-4NA', where Xaa is the AA tested, was found to be Phe > Ala > Leu.
  • Cellular localizationCytoplasmic

Recombinant E. coli slyD protein images

  • SDS-PAGE showing ab72847 (3µg) at approximately 21kDa.

References for Recombinant E. coli slyD protein (ab72847)

ab72847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab72847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"