Recombinant E. coli sodA protein (ab106893)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP00448
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMSYTLPSLPYAYDALEPHFDKQTMEIHHTK HHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHA NHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWA WLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQN RRPDYIKEFWNVVNWDEAAARFAAKK
    • Molecular weight25 kDa including tags
    • Amino acids1 to 206
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab106893 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • ECK3901
    • Superoxide dismutase [Mn]
  • RelevanceSuperoxide dismutase, Mn, also known as sodA, is a member of the iron/manganese superoxide dismutase family. SodA destroys radicals which are normally produced within the cells and which are toxic to biological systems. It works by catalyzing the dismutation of the superoxide radical O2- to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase.

Recombinant E. coli sodA protein images

  • 15% SDS-PAGE showing ab106893 at approximately 25.2kDa (3µg).

References for Recombinant E. coli sodA protein (ab106893)

ab106893 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"