Recombinant E. coli Thermosensitive gluconokinase protein (ab187431)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGESFILMGVSGSGKTLIGSKVAALL SAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPWLERLNDASYSLYKKNET GFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRAGHFMPVA LLKSQFEALERPQADEQDIVRIDINHDIANVTEQCRQAVLAIRQNRICAK EGSASDQRCE
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 187
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No.: NP_418689)

Specifications

Our Abpromise guarantee covers the use of ab187431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab187431 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.88% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • D-gluconate kinase thermosensitive
    • ECK4261
    • gntV
    • idnk
    • JW4225
    see all
  • Relevance
    D-gluconate kinase, thermosensitive, also known as idnk, D-gluconate kinase, thermosensitive, also known as idnk, is a 187 amino acid protein that belongs to the gluconokinase gntK/gntV family and catalyzes the conversion of ATP and D-gluconate to ADP and 6-phospho-D-gluconate.

Images

  • 15% SDS-PAGE analysis of 3µg ab187431.

References

ab187431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up