Recombinant E. coli Thioredoxin 1 protein (ab167980)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKV GALSKGQLKEFLDANLAGS
    • Molecular weight
      13 kDa including tags
    • Amino acids
      2 to 109
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is 16-18 A650/min/mg, obtained by measuring the increase of insulin precipitation in absorbance at 650 nm resulting from the reduction of insulin.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ADF
    • ATL-derived factor
    • SASP
    • Surface associated sulphydryl protein
    • TRN
    • TXN
    • TXN 1
    see all
  • Relevance
    Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/ dithiol group within the conserved Cys-Gly-Pro-Cys active site. Specific protein disulfide targets for reduction by Trx include protein disulfide –isomerase (PDI) and a number of transcription factors such as p53, NFkB and AP-1. Trx is also apable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS PAGE analysis of ab167980 at 3 µg.

References

ab167980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up