Overview

  • Product name
    Recombinant E. coli tpx protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTL VAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVV LCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGL AARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
    • Molecular weight
      20 kDa
    • Amino acids
      1 to 168
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107132 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Scavengase P20
    • Thiol peroxidase
    • tpx
    • TPX_ECOLI
  • Function
    Has antioxidant activity. Could remove peroxides or H(2)O(2) within the catalase- and peroxidase-deficient periplasmic space.
  • Sequence similarities
    Belongs to the ahpC/TSA family. Tpx subfamily.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Periplasm.
  • Information by UniProt

Recombinant E. coli tpx protein images

  • 15% SDS-PAGE showing ab107132 (3µg).

References for Recombinant E. coli tpx protein (ab107132)

ab107132 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up