Overview

  • Product nameRecombinant E. coli tpx protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0A862
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMSQTVHFQGNPVTVANSIPQAGSKAQTFTL VAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVV LCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGL AARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
    • Molecular weight20 kDa
    • Amino acids1 to 168
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab107132 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Scavengase P20
    • Thiol peroxidase
    • tpx
    • TPX_ECOLI
  • FunctionHas antioxidant activity. Could remove peroxides or H(2)O(2) within the catalase- and peroxidase-deficient periplasmic space.
  • Sequence similaritiesBelongs to the ahpC/TSA family. Tpx subfamily.
    Contains 1 thioredoxin domain.
  • Cellular localizationPeriplasm.
  • Information by UniProt

Recombinant E. coli tpx protein images

  • 15% SDS-PAGE showing ab107132 (3µg).

References for Recombinant E. coli tpx protein (ab107132)

ab107132 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"