Overview

  • Product nameRecombinant E. coli udp protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP12758
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMSKSDVFHLGLTKNDLQGATLAIVPGDPDR VEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEE LAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPA VADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHF KGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPN AETMKQTESHAVKIVVEAARRLL
    • Molecular weight29 kDa including tags
    • Amino acids1 to 253
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99262 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • UPase
    • UrdPase
    • uridine phosphorylase
  • RelevanceUridine phosphorypase(UDP) catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. This enzyme belongs to the family of glycosyltransferases, specifically the pentosyltransferases. The systematic name of this enzyme class is uridine:phosphate alpha-D-ribosyltransferase.
  • Cellular localizationCytoplasmic

Recombinant E. coli udp protein images

  • 15% SDS-PAGE showing ab99262 (3µg).

References for Recombinant E. coli udp protein (ab99262)

ab99262 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"