Recombinant Firefly Firefly Luciferase protein (ab100961)

Overview

  • Product name
    Recombinant Firefly Firefly Luciferase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Firefly
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMEDAKNIKKGPAPFYPLEDGTAGEQLHKA MKRYALVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIV VCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVS KKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEY DFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGN QIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQD YKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAK RFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTG KTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDED EHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGE LPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGK LDARKIREILIKAKKGGKIAV
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 550
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab100961 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ec 1.13.12.7
    • Firefly
    • Luciferase
    • Luciferin 4 monooxygenase
  • Relevance
    Luciferase from the firefly has become one of the more widely used reporter proteins for the study of gene expression. Luciferase catalyzes a bioluminescent reaction which requires the substrate luciferin as well as Mg2+ and ATP. Mixing these reagents with the cell extract containing luciferase, results in a flash of light that decays rapidly. This light can be detected by a luminometer. The total light emission is proportional to the luciferase activity of the sample.
  • Cellular localization
    Peroxisome

Images

  • 15% SDS-PAGE showing ab100691 (3 µg) at approximately 62.9 kDa.

References

ab100961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

Our EasyLink conjugation kits are used to conjugate prepared enzymatic, fluorescent or biotin/streptavidin conjugates to antibodies.

http://www.abcam.com/index.html?pageconfig=resource&rid=13148#enz...

Read More

Thank you for your inquiry. The MSDS is linked to each online datasheet where the product requires one.  It is on the right hand side of the page under the shipping and pricing information (under the "Datasheet PDF" link). For ab290: http:/...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up