Recombinant Glutamyl endopeptidase protein (ab98127)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0C1U8
    • SequenceLPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHV VDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPN EQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITY LKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENV RNFLKQNIEDIHFANDDQPNNPDNPDNPNNPDNPNNPDEPNNPDNPNNPD NPDNGDNNNSDNPDAA
    • Molecular weight29 kDa
    • Amino acids71 to 336

Specifications

Our Abpromise guarantee covers the use of ab98127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0
  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    ab98127 is sterile filtered through a 0.2 micron filter. Purity is > 95% by SDS-PAGE gel and HPLC analyses.
  • FormLyophilised
  • Additional notesab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0 ab98127 cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Reaction Buffer: 10 mM Tris, pH 8.0
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10mM Tris, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionThe lyophilized protein is stable at room temperature for up to 1 month. Reconstitute in water to a concentration of 0.1-1.0 mg/ml.

General Info

  • Alternative names
    • Endoproteinase Glu C
    • sspA
    • Staphylococcal serine proteinase
    • V8 protease
    • V8 proteinase
    see all
  • RelevanceGlutamyl endopeptidase preferentially cleaves peptide bonds on the carboxyl-terminal side of aspartate and glutamate. Along with other extracellular proteases it is involved in colonization and infection of human tissues. It is required for proteolytic maturation of thiol protease sspB and inactivation of sspC, an inhibitor of sspB. It is the most important protease for degradation of fibronectin-binding protein (FnBP) and surface protein A, which are involved in adherence to host cells. It may also protect bacteria against host defense mechanism by cleaving the immunoglobulin classes IgG, IgA and IgM. It may be involved in the stability of secreted lipases.

References for Recombinant Glutamyl endopeptidase protein (ab98127)

ab98127 has not yet been referenced specifically in any publications.

Product Wall

Currently, we do not have antibodies against the active Glutamyl endopeptidase protein (ab98127). Apologies!

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"