Recombinant Hepatitis B Surface Antigen (Adw) protein (ab167754)

Overview

Description

  • Nature
    Recombinant
  • Source
    Saccharomyces cerevisiae
  • Amino Acid Sequence
    • Accession
    • Sequence
      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVL LDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNC TCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPT VWLSA IWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
    • Molecular weight
      24 kDa
    • Amino acids
      1 to 226

Specifications

Our Abpromise guarantee covers the use of ab167754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Sandwich ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 97 % SDS-PAGE.
    ab167754 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 93% Phosphate Buffer, 5% Trehalose, 1.17% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • HBsAg
    • S gene subtype adw2
    • sAg
    • ssAg
  • Relevance
    Hepatitis B Virus (HBV) infection induces a disease state characterised by liver damage, inflammation and viral persistence. Infection also increases the risk of hepatocellular carcinoma. HBV belongs to the Hepadnaviridae family of viruses. Its genome consists of partially double stranded circular DNA. The DNA is enclosed in a nucleocapsid, or core antigen (HBcAg), which is surrounded by a spherical envelope (surface antigen or HBsAg). The core antigen shares its sequences with the e antigen (HBeAg) but no cross reactivity between the two proteins has been observed. The HBV genome also encodes a DNA polymerase that also acts as a reverse transcriptase. Hepatitis B infection is normally diagnosed from serological tests that detect HBsAg but as the disease progresses this antigen may no longer be present in the blood and tests for HBcAg are used. If HBsAg can be detected in the blood for longer than six months, chronic hepatitis B is diagnosed. The antigenic determinant of the protein moiety of the HBsAg determines specific characteristics of different serotypes and provides the basis of immunodetection. HBsAg has antigenic heterogeneity, specifically, two pairs of sub specific determinants, d/y and w/r allow the following combinations: adw, ayw, adr, ayr.
  • Cellular localization
    Membrane Virion

Images

  • SDS-PAGE analysis of ab167754 stained overnight with Coomassie Blue.

References

ab167754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up