Recombinant Hepatitis E Virus ORF2 antigen protein (ab49036)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Sequence
      SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRVVIQDYDNQHEQDRP TPSPAPSRP
    • Amino acids
      403 to 461

Specifications

Our Abpromise guarantee covers the use of ab49036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 8M Urea, 20mM Tris HCl, 10mM Beta mercaptoethanol, pH 8.0

General Info

  • Alternative names
    • Hepatitis E Virus ORF2
    • HEV ORF2
  • Relevance
    The Hepatitis E Virus ORF2 antigen contains a high basic amino acid content, suggesting that it may be involved in the encapsidation of the genomic RNA by effectively neutralizing the negatively charged RNA.

References

ab49036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab49036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up