Recombinant HlgC protein (His tag) (ab190123)

Overview

  • Product name
    Recombinant HlgC protein (His tag)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence
      ANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQNIQFDFVKDKKYNKDALIL KMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYVSLINYLPKN KIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQ QNSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSEL PPLVQSGFNPSFIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGN SYLDGHRVHNAFVNRNYTVKYEVNWKTHEIKVKGQN
    • Molecular weight
      33 kDa including tags
    • Amino acids
      30 to 315

Specifications

Our Abpromise guarantee covers the use of ab190123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Cytotoxicity can be detected in Human neutrophils when used in combination with Hlg B in a concentration range of 0.03-100 nM.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Gamma-hemolysin component C
    • hlgC
    • SA2208
  • Relevance
    Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity.
  • Cellular localization
    extracellular region

Images

  • All lanes : Rabbit polyclonal anti HIgC at 0.5 µg/ml

    Lane 1 : Recombinant HlgC protein (His tag) (ab190123) at 0.4 µg
    Lane 2 : Recombinant HlgC protein (His tag) (ab190123) at 0.2 µg
    Lane 3 : Recombinant HlgC protein (His tag) (ab190123) at 0.1 µg
    Lane 4 : Recombinant HlgC protein (His tag) (ab190123) at 0.05 µg
    Lane 5 : Recombinant HlgC protein (His tag) (ab190123) at 0.025 µg
    Lane 6 : Recombinant HlgC protein (His tag) (ab190123) at 0.0125 µg

    Secondary
    anti-rabbit IgG-alkaline phosphatase (AP) conjugate, followed by AP substrate.
  • SDS-PAGE and stain demonstrating 1 μg and 5 μg (lanes 1 and 2, respectively) of protein ab190123 under denaturing and reducing conditions.

  • Toxin Functionality: Human promyleocytic leukemia cell line HL60 was differentiated into neutrophils by treatment with DMSO. Neutrophils were incubated with serial dilutions of ab190123 and HlgC at equimolar concentration for 48 hours at 37°C with 5% CO2 and 95% humidity. Cellular viability was determined by adding XTT and incubation for additional 16 hours. OD’s were determined in the supernatants at 470nm. EC50 was found to be 8.92 nM of each toxin subunit.

References

ab190123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up