Overview

  • Product name
    Recombinant Hongotoxin1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Centruroides limbatus
    • Sequence
      TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH

Specifications

Our Abpromise guarantee covers the use of ab57647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

  • Reconstitution
    Soluble in aqueous buffer.

General Info

  • Alternative names
    • HgTX 1
    • HgTX1
    • Hongotoxin 1
    • Potassium channel toxin alpha KTx 2.5
  • Relevance
    Hongotoxin1 is a 39aa peptide recently isolated from the venom of Centruroides limbatus, which blocks the voltage-gated K+ channels Kv1.1, Kv1.2, and Kv1.3 at picomolar toxin concentrations.
  • Cellular localization
    Secreted

References for Recombinant Hongotoxin1 protein (ab57647)

ab57647 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab57647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up