Overview

  • Product name
    Recombinant Hongotoxin1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Centruroides limbatus
    • Sequence
      TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH

Specifications

Our Abpromise guarantee covers the use of ab57647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

  • Reconstitution
    Soluble in aqueous buffer.

General Info

  • Alternative names
    • HgTX 1
    • HgTX1
    • Hongotoxin 1
    • Potassium channel toxin alpha KTx 2.5
  • Relevance
    Hongotoxin1 is a 39aa peptide recently isolated from the venom of Centruroides limbatus, which blocks the voltage-gated K+ channels Kv1.1, Kv1.2, and Kv1.3 at picomolar toxin concentrations.
  • Cellular localization
    Secreted

References

ab57647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab57647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up