Recombinant Human 12 Lipoxygenase protein (ab112250)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFD HDVAEDLGLLQFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWV QGEDILSLPEGTARLPGDNALDMFQKHREKELKDRQQIYCWATWKEGLPL TIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLSSWNCL EDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSR LVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNS DFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEIN TRARTQLISDGGIFDKAVSTGGGGHVQLLRRAAAQLTYCSLCPPDDLADR GLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCR EITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDW YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYE YLKPSCIENSVTI
    • Molecular weight
      99 kDa including tags
    • Amino acids
      1 to 663
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 12 LOX
    • 12(S) lipoxygenase
    • 12-lipoxygenase
    • 12LO
    • 12S LOX
    • 12S-lipoxygenase
    • 12S-LOX
    • 12S-type
    • Alox12
    • Arachidonate 12 lipoxygenase
    • Arachidonate 12 lipoxygenase, 12S type
    • Arachidonate 12-lipoxygenase
    • Arachidonate 12-oxidoreductase
    • Lipoxin synthase 12-LO
    • LOG12
    • LOX12_HUMAN
    • P-12LO
    • Platelet 12-LOX
    • Platelet type lipoxygenase 12
    • platelet-type 12-lipoxygenase
    • Platelet-type lipoxygenase 12
    see all
  • Function
    Oxygenase and 14,15-leukotriene A4 synthase activity.
  • Pathway
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities
    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human 12 Lipoxygenase protein images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112250

References for Recombinant Human 12 Lipoxygenase protein (ab112250)

ab112250 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up