Recombinant Human 12 Lipoxygenase protein (ab112250)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP18054
    • SpeciesHuman
    • SequenceMGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFD HDVAEDLGLLQFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWV QGEDILSLPEGTARLPGDNALDMFQKHREKELKDRQQIYCWATWKEGLPL TIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLSSWNCL EDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSR LVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNS DFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEIN TRARTQLISDGGIFDKAVSTGGGGHVQLLRRAAAQLTYCSLCPPDDLADR GLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCR EITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDW YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYE YLKPSCIENSVTI
    • Molecular weight99 kDa including tags
    • Amino acids1 to 663
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 12 LOX
    • 12(S) lipoxygenase
    • 12-lipoxygenase
    • 12LO
    • 12S LOX
    • 12S-lipoxygenase
    • 12S-LOX
    • 12S-type
    • Alox12
    • Arachidonate 12 lipoxygenase
    • Arachidonate 12 lipoxygenase, 12S type
    • Arachidonate 12-lipoxygenase
    • Arachidonate 12-oxidoreductase
    • Lipoxin synthase 12-LO
    • LOG12
    • LOX12_HUMAN
    • P-12LO
    • Platelet 12-LOX
    • Platelet type lipoxygenase 12
    • platelet-type 12-lipoxygenase
    • Platelet-type lipoxygenase 12
    see all
  • FunctionOxygenase and 14,15-leukotriene A4 synthase activity.
  • PathwayLipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similaritiesBelongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human 12 Lipoxygenase protein images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112250

References for Recombinant Human 12 Lipoxygenase protein (ab112250)

ab112250 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"