Recombinant Human 14-3-3 eta protein (ab116442)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQLLQRARLAEQ AERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSI EQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQ YESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSY KDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 246
    • Tags
      His tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 80 % Purified via His tag.
    ab116442 was purified by Ni2+-NTA agarose
  • Form
    Liquid
  • Additional notes
    ab116442 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 67% sequence coverage of 14-3-3 eta. Theoretical pI: 5.3
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF

General Info

  • Alternative names
    • 14 3 3 protein eta
    • 14-3-3 eta
    • 14-3-3 protein eta
    • 1433F_HUMAN
    • Brain protein 14-3-3, eta isoform
    • HGNC:12853
    • Protein AS1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, eta isoform
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide
    • YWHA 1
    • YWHA1
    • Ywhah
    see all
  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificity
    Expressed mainly in the brain and present in other tissues albeit at lower levels.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Information by UniProt

Recombinant Human 14-3-3 eta protein images

  • 12 % SDS-PAGE gel showing ab116442.

References for Recombinant Human 14-3-3 eta protein (ab116442)

ab116442 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up