Recombinant Human 14-3-3 gamma protein (ab116443)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61981
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVDREQLVQKARLAEQ AERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSI EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQ YESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSY KDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
    • Molecular weight32 kDa including tags
    • Amino acids1 to 247
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity> 80 % Purified via His tag.

  • FormLiquid
  • Additional notesab116443 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 51 % sequence coverage of 14-3-3 gamma. Theoretical pI: 5.34
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF

General Info

  • Alternative names
    • 14 3 3 gamma
    • 14 3 3 protein gamma
    • 14 3 3 protein gamma subtype
    • 14 3 3gamma
    • 14-3-3 protein gamma
    • 1433G_HUMAN
    • 3 monooxygenase/tryptophan 5 monooxgenase activation protein gamma polypeptide
    • KCIP 1
    • KCIP-1
    • KCIP1
    • N-terminally processed
    • Protein kinase C inhibitor protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein gamma polypeptide
    • Ywhag
    see all
  • FunctionAdapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificityHighly expressed in brain, skeletal muscle, and heart.
  • Sequence similaritiesBelongs to the 14-3-3 family.
  • Post-translational
    modifications
    Phosphorylated by various PKC isozymes.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human 14-3-3 gamma protein images

  • 12 % SDS-PAGE gel showing ab116443.

References for Recombinant Human 14-3-3 gamma protein (ab116443)

ab116443 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"