Recombinant Human 14-3-3 Tau protein (ab116444)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMEKTELIQKAKLAEQA ERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIE QKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKV FYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPI RLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTL IMQLLRDNLTLWTSDSAGEECDAAEGAEN
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 245
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 80 % Purified via His tag.
    ab116444 was purified via Ni2+-NTA agarose columns.
  • Form
    Liquid
  • Additional notes
    ab116444 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF mass spectrometry. The peptides obtained gave 64 % sequence coverage of 14-3-3 theta. Theoretical pI: 5.2
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.004% PMSF, 0.012% Benzamidine

General Info

  • Alternative names
    • 14 3 3 protein T cell
    • 14 3 3 protein tau
    • 14 3 3 protein theta
    • 14 3 3 tau
    • 14 3 3 theta
    • 14-3-3 protein T-cell
    • 14-3-3 protein tau
    • 14-3-3 protein theta
    • 1433T_HUMAN
    • 1C5
    • HS1
    • KCIP1
    • Protein HS1
    • Protein kinase C inhibitor protein 1
    • Protein tau
    • tyr3/trp5 monooxygenase activation protein, theta
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, theta polypeptide
    • Ywhaq
    see all
  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
  • Tissue specificity
    Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression in individuals with predominant lower motor neuron involvement.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    Ser-232 is probably phosphorylated by CK1.
  • Cellular localization
    Cytoplasm. In neurons, axonally transported to the nerve terminals.
  • Information by UniProt

Images

  • 12% SDS-PAGE gel showing ab116444.

References

ab116444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up