Recombinant Human 14-3-3 zeta protein (ab116445)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMDKNELVQKAKLAEQA ERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIE QKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKV FYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPI RLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTL IMQLLRDNLTLWTSDTQGDEAEAGEGGEN
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 245
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 80 % Purified via His tag.

  • Form
    Liquid
  • Additional notes
    ab116445 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 77 % sequence coverage of 14-3-3 zeta. Theoretical pI: 5.23
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.6% HEPES, 50% Glycerol, 0.02% DTT, 0.003% PMSF, 0.012% Benzamidine

General Info

  • Alternative names
    • 14 3 3 delta
    • 14 3 3 protein zeta/delta
    • 14 3 3 protein/cytosolic phospholipase A2
    • 14 3 3 zeta
    • 14-3-3 protein zeta/delta
    • 1433Z_HUMAN
    • Epididymis luminal protein 4
    • Epididymis secretory protein Li 3
    • HEL S 3
    • HEL4
    • KCIP-1
    • KCIP1
    • MGC111427
    • MGC126532
    • MGC138156
    • Phospholipase A2
    • Protein kinase C inhibitor protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein, zeta polypeptide
    • YWHAD
    • YWHAZ
    see all
  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    The delta, brain-specific form differs from the zeta form in being phosphorylated (By similarity). Phosphorylation on Ser-184 by MAPK8; promotes dissociation of BAX and translocation of BAX to mitochondria. Phosphorylation on Ser-58 by PKA; disrupts homodimerization and heterodimerization with YHAE and TP53. This phosphorylation appears to be activated by sphingosine. Phosphorylation on Thr-232; inhibits binding of RAF1.
  • Cellular localization
    Cytoplasm. Melanosome. Located to stage I to stage IV melanosomes.
  • Information by UniProt

Recombinant Human 14-3-3 zeta protein images

  • 12% SDS-PAGE gel showing ab116445.

References for Recombinant Human 14-3-3 zeta protein (ab116445)

ab116445 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up