Recombinant Human 14-3-3 zeta protein (ab116445)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMDKNELVQKAKLAEQA ERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIE QKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKV FYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPI RLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTL IMQLLRDNLTLWTSDTQGDEAEAGEGGEN
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 245
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 80 % Purified via His tag.

  • Form
    Liquid
  • Additional notes
    ab116445 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 77 % sequence coverage of 14-3-3 zeta. Theoretical pI: 5.23
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.6% HEPES, 50% Glycerol, 0.02% DTT, 0.003% PMSF, 0.012% Benzamidine

General Info

  • Alternative names
    • 14 3 3 delta
    • 14 3 3 protein zeta/delta
    • 14 3 3 protein/cytosolic phospholipase A2
    • 14 3 3 zeta
    • 14-3-3 protein zeta/delta
    • 1433Z_HUMAN
    • Epididymis luminal protein 4
    • Epididymis secretory protein Li 3
    • HEL S 3
    • HEL4
    • KCIP-1
    • KCIP1
    • MGC111427
    • MGC126532
    • MGC138156
    • Phospholipase A2
    • Protein kinase C inhibitor protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein, zeta polypeptide
    • YWHAD
    • YWHAZ
    see all
  • Function
    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Sequence similarities
    Belongs to the 14-3-3 family.
  • Post-translational
    modifications
    The delta, brain-specific form differs from the zeta form in being phosphorylated (By similarity). Phosphorylation on Ser-184 by MAPK8; promotes dissociation of BAX and translocation of BAX to mitochondria. Phosphorylation on Ser-58 by PKA; disrupts homodimerization and heterodimerization with YHAE and TP53. This phosphorylation appears to be activated by sphingosine. Phosphorylation on Thr-232; inhibits binding of RAF1.
  • Cellular localization
    Cytoplasm. Melanosome. Located to stage I to stage IV melanosomes.
  • Information by UniProt

Images

  • 12% SDS-PAGE gel showing ab116445.

References

ab116445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up