Recombinant Human 15 Lipoxygenase 1 protein (ab114421)

Overview

  • Product name
    Recombinant Human 15 Lipoxygenase 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELK VEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWV EGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLIL NMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPAR LVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADR GLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCR EITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDW YSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEY LRPSVVENSVAI
    • Molecular weight
      99 kDa including tags
    • Amino acids
      1 to 662

Specifications

Our Abpromise guarantee covers the use of ab114421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 15 lipoxygenase 1
    • 15 LIPOXYGENASE RETICULOCYTE ARACHIDONATE
    • 15 LOX
    • 15 LOX 1
    • 15-LOX
    • 15LOX 1
    • ALOX15
    • Arachidonate 15 lipoxygenase
    • Arachidonate 15-lipoxygenase
    • Arachidonate omega 6 lipoxygenase
    • Arachidonate omega-6 lipoxygenase
    • LOG15
    • LOX15_HUMAN
    see all
  • Function
    Converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. Also acts on C-12 of arachidonate as well as on linoleic acid.
  • Pathway
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities
    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human 15 Lipoxygenase 1 protein images

  • ab114421 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human 15 Lipoxygenase 1 protein (ab114421)

ab114421 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

We do not offer trial size samples which is why we have 100% Abtrial offer, with this offer your next purchase of similar amount will be free of charge. Unfortunately you have to buy the first vial for testing.
Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up