Recombinant Human 15 Lipoxygenase 2 protein (ab114489)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFE HWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      181 to 280

Specifications

Our Abpromise guarantee covers the use of ab114489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 15 LO 2
    • 15 LOX 2
    • 15-lipoxygenase 2
    • 15-LOX-2
    • 15-LOX-B
    • Alox15b
    • Arachidonate 15 lipoxygenase second type
    • Arachidonate 15 lipoxygenase type II
    • Arachidonate 15-lipoxygenase B
    • Arachidonate 15-lipoxygenase type II
    • LX15B_HUMAN
    see all
  • Function
    Converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while linoleic acid is less well metabolized.
  • Tissue specificity
    Expressed in hair, prostate, lung and cornea.
  • Pathway
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities
    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114489 at approximately 36.63kDa stained with Coomassie Blue.

References

ab114489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

We do not offer trial size samples which is why we have 100% Abtrial offer, with this offer your next purchase of similar amount will be free of charge. Unfortunately you have to buy the first vial for testing.
Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up