Recombinant Human 15 Lipoxygenase 2 protein (ab114489)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15296
    • SpeciesHuman
    • SequenceNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFE HWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
    • Molecular weight37 kDa including tags
    • Amino acids181 to 280

Specifications

Our Abpromise guarantee covers the use of ab114489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 15 LO 2
    • 15 LOX 2
    • 15-lipoxygenase 2
    • 15-LOX-2
    • 15-LOX-B
    • Alox15b
    • Arachidonate 15 lipoxygenase second type
    • Arachidonate 15 lipoxygenase type II
    • Arachidonate 15-lipoxygenase B
    • Arachidonate 15-lipoxygenase type II
    • LX15B_HUMAN
    see all
  • FunctionConverts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while linoleic acid is less well metabolized.
  • Tissue specificityExpressed in hair, prostate, lung and cornea.
  • PathwayLipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similaritiesBelongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human 15 Lipoxygenase 2 protein images

  • 12.5% SDS-PAGE showing ab114489 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human 15 Lipoxygenase 2 protein (ab114489)

ab114489 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

We do not offer trial size samples which is why we have 100% Abtrial offer, with this offer your next purchase of similar amount will be free of charge. Unfortunately you have to buy the first vial for testing.
Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"