Recombinant Human 26S proteasome non-ATPase regulatory subunit 12 protein (ab159271)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNL VVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLI AKEEMIHNLQ
    • Amino acids
      347 to 456
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non-ATPase regulatory subunit 12
    • 26S proteasome regulatory subunit p55
    • 26S proteasome regulatory subunit RPN5
    • MGC75406
    • p55
    • proteasome (prosome, macropain) 26S subunit, non ATPase12
    • Proteasome 26S non ATPase subunit 12 isoform 2
    • PSD12_HUMAN
    • PSMD12
    • Rpn5
    see all
  • Function
    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
  • Sequence similarities
    Belongs to the proteasome subunit p55 family.
    Contains 1 PCI domain.
  • Information by UniProt

Images

  • ab159271 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up