Recombinant Human 5 Lipoxygenase protein (ab114310)

Overview

  • Product nameRecombinant Human 5 Lipoxygenase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09917
    • SpeciesHuman
    • SequenceMPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGA VDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPC YRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNP GFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS SWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCT ELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH VRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLC FPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVV EEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQ HAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIA ERNKKKQLPYYYLSPDRIPNSVAI
    • Molecular weight100 kDa including tags
    • Amino acids1 to 674

Specifications

Our Abpromise guarantee covers the use of ab114310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 5 LO
    • 5 LOX
    • 5-lipoxygenase
    • 5-LO
    • 5-LOX
    • 5LOX
    • 5LPG
    • ALOX 5
    • Alox5
    • Arachidonate 5 lipoxygenase
    • Arachidonate 5-lipoxygenase
    • arachidonic 5-lipoxygenase alpha-10 isoform
    • arachidonic 5-lipoxygenase delta-10-13 isoform
    • arachidonic 5-lipoxygenase delta-13 isoform
    • arachidonic 5-lipoxygenase delta-p10 isoform
    • Arachidonic acid 5 lipoxygenase
    • Leukotriene A4 synthase
    • LOG 5
    • LOG5
    • LOX5_HUMAN
    • MGC163204
    see all
  • FunctionCatalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
  • PathwayLipid metabolism; leukotriene A4 biosynthesis.
  • Sequence similaritiesBelongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Post-translational
    modifications
    Serine phosphorylation by MAPKAPK2 is stimulated by arachidonic acid. Phosphorylation on Ser-523 by PKA has an inhibitory effect. Phosphorylation on Ser-272 prevents export from the nucleus.
  • Cellular localizationCytoplasm. Nucleus matrix. Nucleus membrane. Shuttles between cytoplasm and nucleus. Found exclusively in the nucleus, when phosphorylated on Ser-272. Calcium binding promotes translocation from the cytosol and the nuclear matrix to the nuclear envelope and membrane association.
  • Information by UniProt

Recombinant Human 5 Lipoxygenase protein images

  • SDS-PAGE analysis of ab114310 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human 5 Lipoxygenase protein (ab114310)

ab114310 has not yet been referenced specifically in any publications.

Product Wall

Te pido disculpas por la espera.

He confirmado con mis compañeros del laboratorio que la proteína ab114310 puede también utilizarse como control positivo para el anticuerpo ab59341.

Si tuvieras cualquier otra co...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"