Recombinant Human 53BP2/ASPP2 protein (ab152759)

Overview

  • Product name
    Recombinant Human 53BP2/ASPP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPS VGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      512 to 611

Specifications

Our Abpromise guarantee covers the use of ab152759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 53BP2
    • Apoptosis stimulating of p53 protein 2
    • Apoptosis stimulating protein of p53 2
    • Apoptosis-stimulating of p53 protein 2
    • ASPP2
    • ASPP2_HUMAN
    • BBP
    • Bcl2 binding protein
    • Bcl2-binding protein
    • NY REN 51 antigen
    • p53 binding protein 2
    • p53-binding protein 2
    • p53BP2
    • PPP1R13A
    • Renal carcinoma antigen NY-REN-51
    • Tp53bp2
    • Tumor protein p53 binding protein 2
    • Tumor suppressor p53 binding protein 2
    • Tumor suppressor p53-binding protein 2
    see all
  • Function
    Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of APPBP1 to conjugate NEDD8 to CUL1, and thereby decreases APPBP1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42.
  • Tissue specificity
    Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte. Reduced expression in breast carcinomas expressing a wild-type TP53 protein. Overexpressed in lung cancer cell lines.
  • Sequence similarities
    Belongs to the ASPP family.
    Contains 2 ANK repeats.
    Contains 1 SH3 domain.
  • Domain
    The ankyrin repeats and the SH3 domain are required for a specific interactions with TP53.
  • Cellular localization
    Cytoplasm > perinuclear region. Nucleus. Predominantly found in the perinuclear region. Some small fraction is nuclear. Sequester in the cytoplasm on overexpression of DDX42.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152759 stained with Coomassie Blue.

References

ab152759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up