Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 36
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 HT 1A
    • 5 HT receptor 1A
    • 5 HT1A
    • 5 HT1A receptor
    • 5 hydroxytryptamine (serotonin) receptor 1A
    • 5 hydroxytryptamine (serotonin) receptor 1A G protein coupled
    • 5 hydroxytryptamine receptor 1A
    • 5-HT-1A
    • 5-HT1A
    • 5-hydroxytryptamine receptor 1A
    • 5HT 1A
    • 5HT 1A receptor
    • 5HT receptor 1A
    • 5HT1a
    • 5HT1A_HUMAN
    • ADRB2RL1
    • ADRBRL1
    • G 21
    • G protein coupled receptor
    • G-21
    • Gpcr 18
    • Gpcr18
    • Guanine nucleotide binding regulatory protein-coupled receptor
    • Htr1a
    • PFMCD
    • Serotonin 1A receptor
    • Serotonin 5HT1A receptor
    • Serotonin receptor 1A
    see all
  • Function
    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family. 5-hydroxytryptamine receptor subfamily. HTR1A sub-subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152462 stained with Coomassie Blue.

References

This product has been referenced in:
  • Wang GD  et al. Mast cell expression of the serotonin1A receptor in guinea pig and human intestine. Am J Physiol Gastrointest Liver Physiol 304:G855-63 (2013). Read more (PubMed: 23518679) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up