Recombinant Human 5HT2B Receptor protein (ab114546)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQ GNKLHW
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 56

Specifications

Our Abpromise guarantee covers the use of ab114546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 HT 2B
    • 5 HT 2B receptor
    • 5 HT(2B)
    • 5 HT2B
    • 5 hydroxytryptamine (serotonin) receptor 2B
    • 5 hydroxytryptamine (serotonin) receptor 2B G protein coupled
    • 5 hydroxytryptamine 2B receptor
    • 5 hydroxytryptamine receptor 2B
    • 5-HT-2B
    • 5-HT2B
    • 5-hydroxytryptamine receptor 2B
    • 5HT(2B)
    • 5HT2B_HUMAN
    • 5HT2F
    • Htr 2b
    • Htr2b
    • NP75 protein
    • SEROTONIN 5HT2B RECEPTOR
    • Serotonin receptor 2B
    • Stomach fundus serotonin receptor
    see all
  • Function
    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior.
  • Tissue specificity
    Expressed in brain. Higher levels of expression are observed in the cerebellum, occipital cortex and frontal cortex.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114546

References

ab114546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up