Recombinant Human 5HT2B Receptor protein (ab114546)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQ GNKLHW
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 56

Specifications

Our Abpromise guarantee covers the use of ab114546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 HT 2B
    • 5 HT 2B receptor
    • 5 HT(2B)
    • 5 HT2B
    • 5 hydroxytryptamine (serotonin) receptor 2B
    • 5 hydroxytryptamine (serotonin) receptor 2B G protein coupled
    • 5 hydroxytryptamine 2B receptor
    • 5 hydroxytryptamine receptor 2B
    • 5-HT-2B
    • 5-HT2B
    • 5-hydroxytryptamine receptor 2B
    • 5HT(2B)
    • 5HT2B_HUMAN
    • 5HT2F
    • Htr 2b
    • Htr2b
    • NP75 protein
    • SEROTONIN 5HT2B RECEPTOR
    • Serotonin receptor 2B
    • Stomach fundus serotonin receptor
    see all
  • Function
    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior.
  • Tissue specificity
    Expressed in brain. Higher levels of expression are observed in the cerebellum, occipital cortex and frontal cortex.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human 5HT2B Receptor protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114546

References for Recombinant Human 5HT2B Receptor protein (ab114546)

ab114546 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up