Recombinant Human 5HT2C Receptor protein (ab114363)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPD GV
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 52

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 Hydroxytryptamine 2C receptor
    • 5-HT-1C
    • 5-ht-1c receptor
    • 5-HT-2C
    • 5-HT1C
    • 5-HT2C
    • 5-HTR2C
    • 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled
    • 5-hydroxytryptamine receptor 1C
    • 5-hydroxytryptamine receptor 2C
    • 5HT1C
    • 5HT2C
    • 5HT2C_HUMAN
    • 5HTR2C
    • 5Hydroxytryptamine 2C receptor
    • Htr1c
    • HTR2C
    • serotonin 1c receptor
    • serotonin 2c receptor
    • Serotonin 5-HT-2C receptor
    • Serotonin receptor 2C
    see all
  • Function
    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Domain
    The PDZ domain-binding motif is involved in the interaction with MPDZ.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human 5HT2C Receptor protein images

  • 12.5% SDS-PAGE showing ab114363 at approximately 31.35kDa stained with Coomassie Blue.

References for Recombinant Human 5HT2C Receptor protein (ab114363)

ab114363 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.


The QC method for ab114363 and ab132415 is CBR staining. When testing the lab loaded 5uL for quantification.


I hope this information is helpful to you. Please do not hesitate to contact us if yo...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up