Recombinant Human 5HT5A receptor protein (ab114804)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL VAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVH ELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYT LRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKD SAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK NFFSRQH
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 357

Specifications

Our Abpromise guarantee covers the use of ab114804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HTR5A
    • 5 HT 5A
    • 5 hydroxytryptamine 5A receptor
    • 5-HT-5
    • 5-HT-5A
    • 5-HT5A
    • 5-hydroxytryptamine receptor 5A
    • 5HT5A
    • 5HT5A_HUMAN
    • HTR5A
    • Serotonin receptor 5A
    see all
  • Function
    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human 5HT5A receptor protein images

  • ab114804 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human 5HT5A receptor protein (ab114804)

ab114804 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up