Recombinant Human 5HT7 Receptor protein (ab112303)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP34969-3
    • SpeciesHuman
    • SequenceMMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLS EVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC LVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIF GHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMA KMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYI PMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQ CQYRNINRKLSAAGMHEALKLAERPERPEFVL
    • Molecular weight74 kDa including tags
    • Amino acids1 to 432
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • 5 HT 7
    • 5 HT X
    • 5 hydroxytryptamine (serotonin) receptor 7
    • 5 hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase coupled)
    • 5 hydroxytryptamine receptor 7
    • 5-HT-7
    • 5-HT-X
    • 5-HT7
    • 5-hydroxytryptamine receptor 7
    • 5HT7
    • 5HT7R_HUMAN
    • htr7
    • Serotonin 5 HT 7 receptor
    • Serotonin receptor 7
    see all
  • FunctionThis is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
  • Tissue specificityIsoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in term of expression.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human 5HT7 Receptor protein images

  • ab112303 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human 5HT7 Receptor protein (ab112303)

ab112303 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"