Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALK VRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHN FVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTN RQQPSRFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHF PFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSR GGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYR DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQ AQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVA DTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGD FGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGV VLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLS DCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC LLSAARLVP
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 609

Specifications

Our Abpromise guarantee covers the use of ab132213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A raf 1
    • A Raf proto oncogene serine/threonine protein kinase
    • Araf
    • ARAF 1
    • ARaf proto oncogene serine/threonine protein kinase
    • ARAF_HUMAN
    • ARAF1
    • Oncogene Araf1
    • Oncogene PKS2
    • PKS
    • PKS 2
    • PKS2
    • Proto oncogene Pks
    • Proto-oncogene A-Raf
    • Proto-oncogene A-Raf-1
    • Proto-oncogene Pks
    • RAFA 1
    • RAFA1
    • Ras binding protein DA Raf
    • Serine/threonine-protein kinase A-Raf
    • v raf murine sarcoma 3611 viral oncogene homolog
    • v raf murine sarcoma 3611 viral oncogene homolog 1
    • v raf oncogene homolog 1 (murine sarcoma 3611 virus)
    see all
  • Function
    Involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
  • Tissue specificity
    Predominantly in urogenital tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
    Contains 1 RBD (Ras-binding) domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132213 stained with Coomassie Blue.

References

ab132213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up