Overview

  • Product name
    Recombinant Human A1BG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF PVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVL HPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALG DGGHYTCRYRLH DNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRA LRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELHNISVADSA NYSCVYVDLKPPFGGSAPSERL ELHVDGPPPRPQLRATWSGAVLAGRD AVLRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNY RCRYRSWVPHTFESELSDPVELLVAES
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab116793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A1B
    • A1BG
    • A1BG_HUMAN
    • ABG
    • Alpha 1 B glycoprotein
    • Alpha-1-B glycoprotein
    • Alpha-1B-glycoprotein
    • DKFZp686F0970
    • Epididymis secretory sperm binding protein Li 163pA
    • GAB
    • HEL S 163pA
    • HYST2477
    see all
  • Tissue specificity
    Plasma.
  • Sequence similarities
    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116793 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References

ab116793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up