Overview

  • Product name
    Recombinant Human A1BG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF PVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPPVLMHHGESSQVL HPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALG DGGHYTCRYRLH DNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRA LRLRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELHNISVADSA NYSCVYVDLKPPFGGSAPSERL ELHVDGPPPRPQLRATWSGAVLAGRD AVLRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNY RCRYRSWVPHTFESELSDPVELLVAES
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab116793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A1B
    • A1BG
    • A1BG_HUMAN
    • ABG
    • Alpha 1 B glycoprotein
    • Alpha-1-B glycoprotein
    • Alpha-1B-glycoprotein
    • DKFZp686F0970
    • Epididymis secretory sperm binding protein Li 163pA
    • GAB
    • HEL S 163pA
    • HYST2477
    see all
  • Tissue specificity
    Plasma.
  • Sequence similarities
    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human A1BG protein images

  • 12.5% SDS-PAGE showing ab116793 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References for Recombinant Human A1BG protein (ab116793)

ab116793 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up