Overview

  • Product name
    Recombinant Human A2LD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAF RARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDD FESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQ LPHHDSYDSEGPHGLRYNPRENR
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 153
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104748 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • AIG2-like domain-containing protein 1
    • Gamma-glutamylamine cyclotransferase
    • Gamma-glutamylaminecyclotransferase
    • GGACT
    • GGACT_HUMAN
    see all
  • Function
    Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.
  • Sequence similarities
    Belongs to the gamma-glutamylcyclotransferase family.
  • Information by UniProt

Recombinant Human A2LD1 protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human A2LD1 protein (ab104748)

ab104748 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up