Overview

  • Product name
    Recombinant Human A2ML1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRS LTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEF GTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQAT IQYSDPCE
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2ML 1
    • Alpha 2 macroglobulin like 1
    • Alpha 2 macroglobulin like protein 1
    • C3 and PZP like alpha 2 macroglobulin domain containing protein 9
    • CPAMD9
    • DKFZp686C1729
    • DKFZp686D2011
    • DKFZp686G1812
    • DKFZp686L1821
    • DKFZp686O1010
    • FLJ16045
    • FLJ25179
    • FLJ39129
    • FLJ41597
    • FLJ41598
    • FLJ41607
    see all
  • Relevance
    A2ML1 is a new member of the alpha 2-macroglobulin protease inhibitor family, and shares most the characteristics of this family. It is the first family member detected in the epidermis and may play an important role during desquamation by inhibiting extracellular proteases. The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding.
  • Cellular localization
    Secreted

Images

  • ab165513 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up