Recombinant Human A4GALT protein (ab125994)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NPC4
    • SpeciesHuman
    • SequenceNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQ MLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIY LDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDH YNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQ DWKKYFEDINPEE
    • Amino acids91 to 303

Associated products

Specifications

Our Abpromise guarantee covers the use of ab125994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride

  • ReconstitutionReconstitute with water to desired concentration.

General Info

  • Alternative names
    • 4 N acetylglucosaminyltransferase
    • 4-galactosyltransferase
    • 4-N-acetylglucosaminyltransferase
    • A14GALT
    • A4GALT
    • A4GALT1
    • A4GAT_HUMAN
    • Alpha 1 4 galactosyltransferase
    • Alpha 1 4 N acetylglucosaminyltransferase
    • Alpha-1
    • Alpha4Gal T1
    • Alpha4Gal-T1
    • CD77 synthase
    • Gb3 synthase
    • Gb3S
    • Globotriaosylceramide synthase
    • Lactosylceramide 4 alpha galactosyltransferase
    • Lactosylceramide 4-alpha-galactosyltransferase
    • P blood group (P one antigen)
    • P(k) antigen synthase
    • P1
    • P1/Pk synthase
    • PK
    • UDP galactose beta D galactosyl beta1 R 4 alpha D galactosyltransferase
    • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
    see all
  • FunctionNecessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins.
  • Tissue specificityUbiquitous. Highly expressed in kidney, heart, spleen, liver, testis and placenta.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyltransferase 32 family.
  • DomainThe conserved DXD motif is involved in enzyme activity.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

References for Recombinant Human A4GALT protein (ab125994)

ab125994 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"