Recombinant Human AADACL1 protein (ab132863)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLI HYLGLSHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPK PEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLV PKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAAL GQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVK YWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNY KPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVL RDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSY IKWLDQNL
    • Molecular weight
      71 kDa including tags
    • Amino acids
      1 to 408

Specifications

Our Abpromise guarantee covers the use of ab132863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Arylacetamide deacetylase like 1
    • Arylacetamide deacetylase-like 1
    • NCEH
    • Nceh1
    • NCEH1_HUMAN
    • Neutral cholesterol ester hydrolase
    • Neutral cholesterol ester hydrolase 1
    see all
  • Function
    Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration.
  • Tissue specificity
    Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines.
  • Sequence similarities
    Belongs to the 'GDXG' lipolytic enzyme family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane. Microsome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132863 stained with Coomassie Blue.

References

ab132863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up