Recombinant Human AASDHPPT protein (ab99433)

Overview

  • Product name
    Recombinant Human AASDHPPT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPE EKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPV LAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPE FFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGF ELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAV ALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWD CFCFTEEIPIRNGTKS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      14 to 309
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99433 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 4' phosphopantetheinyl transferase
    • 4'-phosphopantetheinyl transferase
    • AASD PPT
    • AASD-PPT
    • AASDHPPT
    • ADPPT_HUMAN
    • Alpha aminoadipic semialdehyde dehydrogenase phosphopantetheinyl transferase
    • Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • CGI 80
    • HAH P
    • L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • LYS2
    • LYS5
    • LYS5 ortholog
    see all
  • Function
    Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.
  • Tissue specificity
    Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
  • Sequence similarities
    Belongs to the P-Pant transferase superfamily. AcpS family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99433 at approximately 36.4kDa (3µg).

References

ab99433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up