Recombinant Human AASDHPPT protein (ab99433)

Overview

  • Product name
    Recombinant Human AASDHPPT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEGVRWAFSCGTWLPSRAEWLLAVRSIQPE EKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPV LAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPE FFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGF ELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAV ALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWD CFCFTEEIPIRNGTKS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      14 to 309
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99433 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 4' phosphopantetheinyl transferase
    • 4'-phosphopantetheinyl transferase
    • AASD PPT
    • AASD-PPT
    • AASDHPPT
    • ADPPT_HUMAN
    • Alpha aminoadipic semialdehyde dehydrogenase phosphopantetheinyl transferase
    • Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • CGI 80
    • HAH P
    • L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
    • LYS2
    • LYS5
    • LYS5 ortholog
    see all
  • Function
    Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.
  • Tissue specificity
    Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.
  • Sequence similarities
    Belongs to the P-Pant transferase superfamily. AcpS family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human AASDHPPT protein images

  • 15% SDS-PAGE showing ab99433 at approximately 36.4kDa (3µg).

References for Recombinant Human AASDHPPT protein (ab99433)

ab99433 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up