Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDF LVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD EEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFS VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGD RNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT TNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQY PDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPS FMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHIL MDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHL KDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSK IHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQ LHPPDEGHGD
    • Amino acids
      1 to 560
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AATF
    • AATF_HUMAN
    • Apoptosis antagonizing transcription factor
    • Apoptosis-antagonizing transcription factor
    • BFR2
    • CHE 1
    • CHE1
    • DED
    • Protein AATF
    • Rb binding protein Che 1
    • Rb-binding protein Che-1
    see all
  • Function
    May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date.
  • Tissue specificity
    Ubiquitously expressed. Expressed at high levels in brain, heart, kidney, placenta and thymus.
  • Sequence similarities
    Belongs to the AATF family.
  • Post-translational
    modifications
    Hyperphosphorylated during the G1/S phase transition.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab162011 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up