Overview

  • Product name
    Recombinant Human ABCA6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGT SVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
    • Amino acids
      53 to 149
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC transporter ABCA6
    • ABCA 6
    • ABCA6
    • ABCA6_HUMAN
    • ATP binding cassette A6
    • ATP binding cassette sub family A (ABC1) member 6
    • ATP binding cassette sub family A member 6
    • ATP-binding cassette sub-family A member 6
    • EST155051
    • FLJ43498
    see all
  • Function
    Probable transporter which may play a role in macrophage lipid homeostasis.
  • Tissue specificity
    Widely expressed with higher expression in liver.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCA family.
    Contains 2 ABC transporter domains.
  • Developmental stage
    Expressed in fetal kidney, lung and liver.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161655 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up