Recombinant Human ABCB10 protein (ab161652)

Overview

  • Product name
    Recombinant Human ABCB10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALL GRSVTENLSDGLRAGAQASVGISMMFFVS
    • Amino acids
      233 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC transporter 10 protein
    • ABCB10
    • ABCB10 ATP binding cassette, sub family B (MDR/TAP), member 10
    • ABCBA_HUMAN
    • ATP binding cassette sub family B member 10, mitochondrial
    • ATP binding cassette transporter 10
    • ATP-binding cassette sub-family B member 10
    • ATP-binding cassette transporter 10
    • EST20237
    • M ABC2
    • M-ABC2
    • mitochondrial
    • Mitochondrial ATP binding cassette 2
    • Mitochondrial ATP-binding cassette 2
    • MTABC2
    see all
  • Function
    May mediate critical mitochondrial transport functions related to heme biosynthesis.
  • Tissue specificity
    Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymph node, trachea and adrenal gland, and low levels are found in lung, kidney, spleen, thymus and colon.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCB family. Mitochondrial peptide exporter (TC 3.A.1.212) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab161652 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up