Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ2M3G0
    • SpeciesHuman
    • SequenceILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVDA KELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANA ANIHSFIEGLPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDE ATSALDNDSEKVVQHALDKARTGRTCLVVTHRLSAIQNADLIVVLHNGKI KEQG
    • Amino acids587 to 790

Specifications

Our Abpromise guarantee covers the use of ab125989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 28.8% Guanidine HCl

  • ReconstitutionReconstitute with water to desired concentration.

General Info

  • Alternative names
    • ABCB 5
    • ABCB5
    • ABCB5 P-gp
    • ABCB5_HUMAN
    • ABCB5alpha
    • ABCB5beta
    • ATP binding cassette protein
    • ATP binding cassette sub family B (MDR/TAP) member 5
    • ATP binding cassette sub family B member 5
    • ATP-binding cassette sub-family B member 5
    • EST422562
    • P glycoprotein ABCB5
    • P-glycoprotein ABCB5
    see all
  • FunctionPlasma membrane transporter able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin. Responsible for the resistance to doxorubicin of a subset of malignant melanomas.
  • Tissue specificityExpressed by CD133-expressing progenitor cells among epidermal melanocytes (at protein level). Widely expressed with specific expression in pigment cells. Also expressed in several malignant tissues.
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 2 ABC transporter domains.
  • Cellular localizationCell membrane.
  • Information by UniProt

References for Recombinant Human ABCB5 protein (ab125989)

ab125989 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"