Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVDA KELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANA ANIHSFIEGLPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDE ATSALDNDSEKVVQHALDKARTGRTCLVVTHRLSAIQNADLIVVLHNGKI KEQG
    • Amino acids
      587 to 790

Specifications

Our Abpromise guarantee covers the use of ab125989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 28.8% Guanidine HCl

  • Reconstitution
    Reconstitute with water to desired concentration.

General Info

  • Alternative names
    • ABCB 5
    • ABCB5
    • ABCB5 P-gp
    • ABCB5_HUMAN
    • ABCB5alpha
    • ABCB5beta
    • ATP binding cassette protein
    • ATP binding cassette sub family B (MDR/TAP) member 5
    • ATP binding cassette sub family B member 5
    • ATP-binding cassette sub-family B member 5
    • EST422562
    • P glycoprotein ABCB5
    • P-glycoprotein ABCB5
    see all
  • Function
    Plasma membrane transporter able to mediate efflux from cells of the rhodamine dye and of the therapeutic drug doxorubicin. Responsible for the resistance to doxorubicin of a subset of malignant melanomas.
  • Tissue specificity
    Expressed by CD133-expressing progenitor cells among epidermal melanocytes (at protein level). Widely expressed with specific expression in pigment cells. Also expressed in several malignant tissues.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab125989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up