Recombinant Human ABCC13 protein (ab165599)

Overview

  • Product name
    Recombinant Human ABCC13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSSTQNAGGSYQRVRGALDTQKCSPEKSASFFSKVTYSWFSRVITLGYK RPLEREDLFELKESDSFCTACPIFEKQWRKEVLRNQERQKVKVSCYKEAH IKKPSLLYALWNTFKSILIQVALFKVFADILSFTSPLIMNYTRKVNYLMG LPCENQKITSYSQASGRDS
    • Amino acids
      1 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP binding cassette protein C13
    • ATP binding cassette, sub family C (CFTR/MRP), member 13
    • C21orf73
    • PRED6
  • Relevance
    This gene is a member of the superfamily of genes encoding ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This family member is part of the MRP subfamily, which is involved in multi drug resistance, but the human locus is now thought to be a pseudogene incapable of encoding a functional ABC protein. It is expressed at its highest level in fetal liver and fetal spleen. In the adult, highest levels are found in the colon ascending and transverse. Also expressed in brain, placenta, lung, liver, pancreas and ovary. In bone marrow cells, levels are several fold higher than in peripheral blood leukocytes. There are five named isoforms.
  • Cellular localization
    Nucleus; integral to membrane.

Images

  • ab165599 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up