Overview

  • Product name
    Recombinant Human ABCD4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI DGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTW LEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREHGLIFMETSA KTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAG NQGGQQAGGGCC
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 69 kDa peroxisomal ABC transporter
    • ABC 41
    • ABC41
    • ABCD 4
    • ABCD4
    • ABCD4_HUMAN
    • ATP binding cassette sub family D (ALD) member 4
    • ATP binding cassette sub family D member 4
    • ATP-binding cassette sub-family D member 4
    • EST352188
    • MAHCJ
    • MGC105956
    • P70R
    • P79R
    • Peroxisomal membrane protein 1 like
    • Peroxisomal membrane protein 1-like
    • Peroxisomal membrane protein 69
    • PMP 69
    • PMP69
    • PMP70-related protein
    • PXMP 1L
    • PXMP1 L
    • PXMP1-L
    • PXMP1L
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization
    Peroxisome membrane.
  • Information by UniProt

Images

  • ab159290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up